PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 457aa    MW: 52573.4 Da    PI: 10.2018
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19242.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-16219265148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd  lv++vk++G + W+ Iar ++ gR +kqc++rw+++l
       KHN19242.1 219 KGQWSAEEDRVLVQLVKRFGLKKWSHIARLLN-GRVGKQCRERWHNHL 265
                      799*****************************.*************97 PP

2Myb_DNA-binding51.91.7e-16271313145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W +eEd +l++a+k  G++ W+ Iar+m+ gRt++ +k++w+
       KHN19242.1 271 KESWNEEEDRILIEAHKGIGNR-WAEIARRMP-GRTENTIKNHWN 313
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.203214269IPR017930Myb domain
SuperFamilySSF466894.12E-30216312IPR009057Homeodomain-like
SMARTSM007177.2E-15218267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-26220272IPR009057Homeodomain-like
CDDcd001677.20E-14222265No hitNo description
PfamPF139214.3E-18222279No hitNo description
SMARTSM007174.1E-15270318IPR001005SANT/Myb domain
PROSITE profilePS5129419.44270320IPR017930Myb domain
CDDcd001671.04E-11273316No hitNo description
Gene3DG3DSA:1.10.10.607.2E-20273318IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MNIPHSHLIL FYFFVSPTGR LHKNPRPHPF SFTSTVQTHK QQHKKSLSLS FMEFDPIFPA  60
EKIHYLSSIF SGIKPEIPAF IPMSQENNNN TTFCMYQNNF KNHDNHHPTA NFFSEGFNSS  120
ILTPLFSLSS SSGDSSYPNE CLKGSFANDN NFYHPIMPYA QNNTQNEPMH GPNRAIWDFS  180
QKIPLRCSSA GAGATSQPHQ MQRRSNGKIQ HKNMTNIIKG QWSAEEDRVL VQLVKRFGLK  240
KWSHIARLLN GRVGKQCRER WHNHLRPNIR KESWNEEEDR ILIEAHKGIG NRWAEIARRM  300
PGRTENTIKN HWNATKRRLN AKRLRNKRRS SKGPTLLESY IRQVTAEEDA EKELIKNSMN  360
NMNLKGERSS NTTNTKTKYP RLFRVRYDSS EGGFSSEEDE VGRGVQQLHG GGGAYVPTMV  420
NAAVEDGTMG YDVAMEMAPE VQMKKEMDLM EMIYRKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-442143182106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555068.10.0PREDICTED: myb-like protein A isoform X2
TrEMBLA0A0B2QHN60.0A0A0B2QHN6_GLYSO; Transcription factor MYB98
STRINGGLYMA19G13923.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-56myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]